McDonnell Genome Institute

Washington University

Transcript

TIPARP-AS1:1

Chromosome

chr3

Gene Name

TIPARP-AS1

Start

156671801

CPC Label

noncoding

End

156675879

Cancer

OV

Strand

-

Peptide

VTPPVGR

Modified Peptide

n[145]VTPPVGR

Peptide Length

7

ORF Length

117

Open Reading Frame (ORF)

LGFCGTPGQKHFPKKLPLQSLPARRRATPRRRARVRVTPPVGRGGLLSSWSRAAPTPRSAAEAPPGSAIPGVPGRPRPRLPLSRRLGAPQLLSSLLRTNDPPRPPCIPETTRGAFSL

Conservation Score

1

PhyloCSF Frame 1

-1.397

No. of Spectra

10

CPC Coding Probability

0.0567756

PhyloCSF Frame 2 

-1.354

CNTI Index

noncoding

Max Probability

0.9521

PhyloCSF Frame 3

0.998

CNTI Score

-0.282487647