McDonnell Genome Institute

Washington University

Transcript

THUMPD3-AS1:79

Chromosome

chr3

Gene Name

THUMPD3-AS1

Start

9336605

CPC Label

noncoding

End

9363022

Cancer

CCRC

Strand

-

Peptide

IHLQALLK

Modified Peptide

IHLQALLK

Peptide Length

8

ORF Length

34

Open Reading Frame (ORF)

LPQLRWSPHSLNTPCRIHLQALLKLFLLFRMWPS

Conservation Score

0.95

PhyloCSF Frame 1

-4.898

No. of Spectra

37

CPC Coding Probability

0.112002

PhyloCSF Frame 2 

-4.821

CNTI Index

coding

Max Probability

0.9999

PhyloCSF Frame 3

-4.455

CNTI Score

0.671181225