McDonnell Genome Institute

Washington University

Transcript

THUMPD3-AS1:67

Chromosome

chr3

Gene Name

THUMPD3-AS1

Start

9378328

CPC Label

noncoding

End

9396647

Cancer

OV

Strand

-

Peptide

DNFKNNAEAVNYITDDTK

Modified Peptide

n[145]DNFKNNAEAVNYITDDTK

Peptide Length

18

ORF Length

46

Open Reading Frame (ORF)

LGDRARPPSQKKGKQTENMIVMQRTAKDNFKNNAEAVNYITDDTKI

Conservation Score

0.492

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0345229

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.5922

PhyloCSF Frame 3

-5.081

CNTI Score

0.614353396