McDonnell Genome Institute

Washington University

Transcript

THUMPD3-AS1:45

Chromosome

chr3

Gene Name

THUMPD3-AS1

Start

9379121

CPC Label

noncoding

End

9398755

Cancer

OV

Strand

-

Peptide

VMPLGSSHLRWEAR

Modified Peptide

n[145]VM[147]PLGSSHLRWEAR

Peptide Length

14

ORF Length

105

Open Reading Frame (ORF)

LWHTPRGARERVVGVAKVMPLGSSHLRWEARKREGRRPGRLRRGDRGPQSDQSCLSQGRENGGREWGIGERKKVCLCISSGGQQEASPQGKGVETGRELELEVKH

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0647814

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.7693

PhyloCSF Frame 3

0

CNTI Score

0.583616125