McDonnell Genome Institute

Washington University

Transcript

THUMPD3-AS1:38

Chromosome

chr3

Gene Name

THUMPD3-AS1

Start

9349684

CPC Label

noncoding

End

9362941

Cancer

BRCA-Basal-like

Strand

-

Peptide

GFSTAMLK

Modified Peptide

n[145]GFSTAM[147]LK

Peptide Length

8

ORF Length

52

Open Reading Frame (ORF)

LRIFSKLKAESQGPCVLPWYLLTFRECFPLPSTGSLLYCTDQEKGFSTAMLK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

39

CPC Coding Probability

0.0293491

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9999

PhyloCSF Frame 3

0

CNTI Score

-0.425921297