McDonnell Genome Institute

Washington University

Transcript

THUMPD3-AS1:1

Chromosome

chr3

Gene Name

THUMPD3-AS1

Start

9385263

CPC Label

noncoding

End

9398579

Cancer

EOGC

Strand

-

Peptide

AGQFLWLYPLR

Modified Peptide

n[145]AGQFLWLYPLR

Peptide Length

11

ORF Length

83

Open Reading Frame (ORF)

MDEELLFRDEQRKWFLEMESTGCSLRAGQFLWLYPLRKHREVCEVKTIVMIARCLSFSFILTVCRGYMMCDDILIDVNEWCYT

Conservation Score

0.345

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.148789

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9062

PhyloCSF Frame 3

0

CNTI Score

-0.409884163