McDonnell Genome Institute

Washington University

Transcript

THSD4-AS1:10

Chromosome

chr15

Gene Name

THSD4-AS1

Start

71185615

CPC Label

coding

End

71189023

Cancer

CCRC

Strand

-

Peptide

LLPLVCFR

Modified Peptide

n[230]LLPLVCFR

Peptide Length

8

ORF Length

118

Open Reading Frame (ORF)

LQGECNSHQPLGLPHCFCSVFQKVFNGGERVWRKGGPCLLADISMQSSPSRHSMSGISPCKGAVIGQWAQSGLWVFLSCCTFDPPSSAEKAAFPLGMPYVWKKLLPLVCFRLYPPTAN

Conservation Score

1

PhyloCSF Frame 1

-3.4

No. of Spectra

1

CPC Coding Probability

0.683988

PhyloCSF Frame 2 

-1.621

CNTI Index

noncoding

Max Probability

0.3902

PhyloCSF Frame 3

-4.886

CNTI Score

-0.36730072