McDonnell Genome Institute

Washington University

Transcript

THRIL:1

Chromosome

chr12

Gene Name

THRIL

Start

125025931

CPC Label

noncoding

End

125029351

Cancer

OV

Strand

-

Peptide

DPQQLQSCK

Modified Peptide

n[145]DPQQLQSCK

Peptide Length

9

ORF Length

41

Open Reading Frame (ORF)

LHAGHCERVARVHLWPGKGHRDSRDPQQLQSCKMLGFFFFF

Conservation Score

0.299

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0902812

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7241

PhyloCSF Frame 3

0

CNTI Score

-0.372950513