McDonnell Genome Institute

Washington University

Transcript

THRB-AS1:11

Chromosome

chr3

Gene Name

THRB-AS1

Start

24496183

CPC Label

noncoding

End

24523228

Cancer

OV

Strand

+

Peptide

ETAESGGPQK

Modified Peptide

n[145]ETAESGGPQK

Peptide Length

10

ORF Length

35

Open Reading Frame (ORF)

LKGGDNFWKHQGLKRKETAESGGPQKQQLAVMFQD

Conservation Score

0.262

PhyloCSF Frame 1

-5.508

No. of Spectra

3

CPC Coding Probability

0.0824274

PhyloCSF Frame 2 

-4.563

CNTI Index

noncoding

Max Probability

0.9025

PhyloCSF Frame 3

-5.552

CNTI Score

-0.387949305