McDonnell Genome Institute

Washington University

Transcript

TEX41:70

Chromosome

chr2

Gene Name

TEX41

Start

145023227

CPC Label

noncoding

End

145152141

Cancer

OV

Strand

+

Peptide

LQLSEPQQIITSEK

Modified Peptide

n[145]LQLSEPQQIITSEK

Peptide Length

14

ORF Length

63

Open Reading Frame (ORF)

LVMPSSVVGQRRNSKALPKTKLAPKKGHGHHLVVCCRCNRLQLSEPQQIITSEKYAQQIDEMY

Conservation Score

0.111

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.210624

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9383

PhyloCSF Frame 3

0

CNTI Score

-0.322485632