McDonnell Genome Institute

Washington University

Transcript

TEX41:4

Chromosome

chr2

Gene Name

TEX41

Start

144667966

CPC Label

noncoding

End

145172078

Cancer

OV

Strand

+

Peptide

LATCLNFISLTSMNSQGPR

Modified Peptide

n[145]LATCLNFISLTSMNSQGPR

Peptide Length

19

ORF Length

36

Open Reading Frame (ORF)

LATCLNFISLTSMNSQGPRKNFHFMFLSSHQFELCL

Conservation Score

0.551

PhyloCSF Frame 1

-5.802

No. of Spectra

1

CPC Coding Probability

0.0554313

PhyloCSF Frame 2 

-5.998

CNTI Index

noncoding

Max Probability

0.1404

PhyloCSF Frame 3

-5.861

CNTI Score

-0.442034006