McDonnell Genome Institute

Washington University

Transcript

TEX41:29

Chromosome

chr2

Gene Name

TEX41

Start

144668018

CPC Label

noncoding

End

144890214

Cancer

OV

Strand

+

Peptide

RLMEDRIYWQQTK

Modified Peptide

n[145]RLMEDRIYWQQTK

Peptide Length

13

ORF Length

119

Open Reading Frame (ORF)

LLSFALGRSIPGSFPAHIFVESPFSKLQCVICEDRDPPGTSPQGIHFRLLLNGQGIMVDPKEASAWLCTKEVFSQVGERSLLKERKRLMEDRIYWQQTKRQNGHTSKCLVQAMVMLLIF

Conservation Score

1

PhyloCSF Frame 1

-4.442

No. of Spectra

5

CPC Coding Probability

0.0413558

PhyloCSF Frame 2 

-4.757

CNTI Index

noncoding

Max Probability

0.6552

PhyloCSF Frame 3

-4.847

CNTI Score

-0.385891971