McDonnell Genome Institute

Washington University

Transcript

TEX41:16

Chromosome

chr2

Gene Name

TEX41

Start

144667984

CPC Label

noncoding

End

145182344

Cancer

EOGC

Strand

+

Peptide

GCLAISLMLEVNLR

Modified Peptide

n[145]GCLAISLMLEVNLR

Peptide Length

14

ORF Length

86

Open Reading Frame (ORF)

MHKVRSIKSHGRRPIIYRRGCLAISLMLEVNLRFSSCLLLSICLDDKPSADELCFWTDHGRSQLTCPSLGVSQGCTDEETETENPE

Conservation Score

1

PhyloCSF Frame 1

-5.236

No. of Spectra

2

CPC Coding Probability

0.230989

PhyloCSF Frame 2 

-4.103

CNTI Index

noncoding

Max Probability

0.531

PhyloCSF Frame 3

-5.09

CNTI Score

-0.3997548