McDonnell Genome Institute

Washington University

Transcript

TEX41:134

Chromosome

chr2

Gene Name

TEX41

Start

145023205

CPC Label

noncoding

End

145271652

Cancer

OV

Strand

+

Peptide

TFGYHLLNQSNMHSPSK

Modified Peptide

n[145]TFGYHLLNQSNMHSPSK

Peptide Length

17

ORF Length

74

Open Reading Frame (ORF)

MTFGYHLLNQSNMHSPSKRHHGTITCFHWLFKFGLQSVCVCMHACMCVCVRVCVCARVCVCMRACVRVCVCVHF

Conservation Score

0.047

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0966766

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1145

PhyloCSF Frame 3

0

CNTI Score

-0.399500943