McDonnell Genome Institute

Washington University

Transcript

TEX26-AS1:33

Chromosome

chr13

Gene Name

TEX26-AS1

Start

30906712

CPC Label

noncoding

End

30921081

Cancer

OV

Strand

-

Peptide

LHGLNYSVLGLR

Modified Peptide

n[145]LHGLNYSVLGLR

Peptide Length

12

ORF Length

49

Open Reading Frame (ORF)

MVLTSNLLTFPVPRIKLHGLNYSVLGLRRHIDTCVLLHLTARDQPLCDF

Conservation Score

0.178

PhyloCSF Frame 1

-4.041

No. of Spectra

1

CPC Coding Probability

0.244415

PhyloCSF Frame 2 

-6.225

CNTI Index

noncoding

Max Probability

0.5719

PhyloCSF Frame 3

-5.454

CNTI Score

-0.27484745