McDonnell Genome Institute

Washington University

Transcript

TEX26-AS1:24

Chromosome

chr13

Gene Name

TEX26-AS1

Start

30881932

CPC Label

noncoding

End

30931283

Cancer

OV

Strand

-

Peptide

ECTTPLPQR

Modified Peptide

n[145]ECTTPLPQR

Peptide Length

9

ORF Length

90

Open Reading Frame (ORF)

LSLQALRGGHSKKPLPDAGTLILDFSASGTVRDGVSLYQLSWSTVVRSELTAASGLLVSSNPDLSLPSSGDYRECTTPLPQREGEKSADG

Conservation Score

0.336

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.00318223

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9958

PhyloCSF Frame 3

0

CNTI Score

-0.410471017