McDonnell Genome Institute

Washington University

Transcript

TET2-AS1:3

Chromosome

chr4

Gene Name

TET2-AS1

Start

105346237

CPC Label

noncoding

End

105352948

Cancer

OSCC

Strand

-

Peptide

LPDLALFK

Modified Peptide

n[145]LPDLALFK

Peptide Length

8

ORF Length

67

Open Reading Frame (ORF)

LLTCGQWLSTLMMRGYKHELVTSKARLPDLALFKEVTRNTKSLTSDMVECGYSNNNLKELAVQKSDS

Conservation Score

0.968

PhyloCSF Frame 1

-6.065

No. of Spectra

47

CPC Coding Probability

0.315648

PhyloCSF Frame 2 

-4.094

CNTI Index

noncoding

Max Probability

1

PhyloCSF Frame 3

-4.502

CNTI Score

-0.391728814