McDonnell Genome Institute

Washington University

Transcript

TESC-AS1:2

Chromosome

chr12

Gene Name

TESC-AS1

Start

117099448

CPC Label

coding

End

117102960

Cancer

EOGC

Strand

+

Peptide

MPPSLLK

Modified Peptide

n[145]M[147]PPSLLK

Peptide Length

7

ORF Length

179

Open Reading Frame (ORF)

LVGAMESCPLERHTARAEHQGQGSPEGSAVLSDTTINDRQVSDLSGNSHPQGGLLRVLIPSPGSTAKQATTTSQQGAGRREVLLRMTEEDLFLIAGLGEVIRRSLEQHEGRKNQGTIYAFVQSFIHCTFIEHLLCSGLLLGPGATARNKMPPSLLKNSWWGEETDTRAVTKQMGKQGLT

Conservation Score

0.688

PhyloCSF Frame 1

-0.188

No. of Spectra

1

CPC Coding Probability

0.966037

PhyloCSF Frame 2 

-3.937

CNTI Index

noncoding

Max Probability

0.2856

PhyloCSF Frame 3

-4.049

CNTI Score

-0.318449016