McDonnell Genome Institute

Washington University

Transcript

TDRKH-AS1:17

Chromosome

chr1

Gene Name

TDRKH-AS1

Start

151790833

CPC Label

coding

End

151800167

Cancer

LUAD

Strand

+

Peptide

MIHSSAVQLSESEK

Modified Peptide

n[230]M[147]IHSSAVQLSESEK

Peptide Length

14

ORF Length

81

Open Reading Frame (ORF)

LKYKEPGSGALAAHRVPSLYNIRMIHSSAVQLSESEKQHSSLLLPIVGVTPSSPLKPLHQKPATGSRALVSSLMLVLLFNL

Conservation Score

0.722

PhyloCSF Frame 1

-4.852

No. of Spectra

5

CPC Coding Probability

0.903469

PhyloCSF Frame 2 

-4.798

CNTI Index

noncoding

Max Probability

0.886

PhyloCSF Frame 3

-1.715

CNTI Score

-0.334611311