McDonnell Genome Institute

Washington University

Transcript

TCL6:9

Chromosome

chr14

Gene Name

TCL6

Start

95652094

CPC Label

noncoding

End

95654780

Cancer

OV

Strand

+

Peptide

VISLCARPECSGAITAHCSLNLLGSR

Modified Peptide

n[145]VISLCARPECSGAITAHCSLNLLGSR

Peptide Length

26

ORF Length

92

Open Reading Frame (ORF)

MKVISLCARPECSGAITAHCSLNLLGSRDPPTSASQAAKTTGTCHHIWQIKKKIIEMGSPCVSLVGLKLLGSSDPPILASQLTGITGICHCA

Conservation Score

0.351

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.109597

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7837

PhyloCSF Frame 3

0

CNTI Score

-0.387685176