McDonnell Genome Institute

Washington University

Transcript

TCF4-AS1:1

Chromosome

chr18

Gene Name

TCF4-AS1

Start

55452532

CPC Label

noncoding

End

55482940

Cancer

EOGC

Strand

+

Peptide

LAFGSAK

Modified Peptide

n[145]LAFGSAK

Peptide Length

7

ORF Length

54

Open Reading Frame (ORF)

LAFGSAKDHPGDWRKEWLVAGATGLLRDKGALDRLAESQARDLKEKVLGKAKLP

Conservation Score

0.171

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.00412472

PhyloCSF Frame 2 

-3.646

CNTI Index

noncoding

Max Probability

0.9651

PhyloCSF Frame 3

0

CNTI Score

-0.377160941