McDonnell Genome Institute

Washington University

Transcript

TBX2-AS1:20

Chromosome

chr17

Gene Name

TBX2-AS1

Start

61392880

CPC Label

noncoding

End

61395574

Cancer

OSCC

Strand

-

Peptide

SAVGGLPSSYTGAR

Modified Peptide

n[145]SAVGGLPSSYTGAR

Peptide Length

14

ORF Length

114

Open Reading Frame (ORF)

LRCQGCHPPLGSCSEFETYRMHCPFASRASSSRSAVGGLPSSYTGAREQLQIQSLSPGRKPDGVRMGISGVSILDGIGAQDREVSSDLGPSKGTGQGVKQPGADRDRLTRRVTL

Conservation Score

0.65

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.115103

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7879

PhyloCSF Frame 3

-4.24

CNTI Score

-0.299635219