McDonnell Genome Institute

Washington University

Transcript

TBX2-AS1:17

Chromosome

chr17

Gene Name

TBX2-AS1

Start

61359178

CPC Label

noncoding

End

61397110

Cancer

EOGC

Strand

-

Peptide

AGVGLTK

Modified Peptide

n[145]AGVGLTK

Peptide Length

7

ORF Length

46

Open Reading Frame (ORF)

MGKERRKKRHVLPSSFPSTLGLRSPRAGVGLTKGSWGQCVSQPDMS

Conservation Score

1

PhyloCSF Frame 1

-2.882

No. of Spectra

65

CPC Coding Probability

0.297347

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9994

PhyloCSF Frame 3

-4.831

CNTI Score

0.740049559