McDonnell Genome Institute

Washington University

Transcript

TBC1D8-AS1:9

Chromosome

chr2

Gene Name

TBC1D8-AS1

Start

101151659

CPC Label

noncoding

End

101155410

Cancer

CCRC

Strand

+

Peptide

KLENLANMCCR

Modified Peptide

n[230]KLENLANM[147]CCR

Peptide Length

11

ORF Length

73

Open Reading Frame (ORF)

MDACSPPNLPLMHLIDSRSITRINSLQSPEGEMQGQPEKRRMEIDYIPRKLENLANMCCREAENCVWEWILKC

Conservation Score

0.452

PhyloCSF Frame 1

-4.689

No. of Spectra

1

CPC Coding Probability

0.102064

PhyloCSF Frame 2 

-3.892

CNTI Index

noncoding

Max Probability

0.9947

PhyloCSF Frame 3

-4.152

CNTI Score

-0.343461267