McDonnell Genome Institute

Washington University

Transcript

TARID:10

Chromosome

chr6

Gene Name

TARID

Start

133502251

CPC Label

noncoding

End

133888982

Cancer

OSCC

Strand

-

Peptide

VFISHAHTVLLSSFLAFPLCCLK

Modified Peptide

n[145]VFISHAHTVLLSSFLAFPLCCLK

Peptide Length

23

ORF Length

39

Open Reading Frame (ORF)

MVFISHAHTVLLSSFLAFPLCCLKFAQIVSDFKSLTDVT

Conservation Score

0.038

PhyloCSF Frame 1

-4.815

No. of Spectra

4

CPC Coding Probability

0.0927172

PhyloCSF Frame 2 

-5.395

CNTI Index

noncoding

Max Probability

0.8573

PhyloCSF Frame 3

-6.89

CNTI Score

-0.399174142