McDonnell Genome Institute

Washington University

Transcript

TAPT1-AS1:13

Chromosome

chr4

Gene Name

TAPT1-AS1

Start

16226662

CPC Label

coding

End

16241286

Cancer

LUAD

Strand

+

Peptide

EWVGLHR

Modified Peptide

n[230]EWVGLHR

Peptide Length

7

ORF Length

42

Open Reading Frame (ORF)

MAGCWENKMFPSTLFLSLTSCLPVPDLVLCKEWVGLHRFLTA

Conservation Score

0.393

PhyloCSF Frame 1

-6.002

No. of Spectra

6

CPC Coding Probability

0.760921

PhyloCSF Frame 2 

-3.562

CNTI Index

coding

Max Probability

0.9958

PhyloCSF Frame 3

-4.923

CNTI Score

0.712707298