McDonnell Genome Institute

Washington University

Transcript

TAPT1-AS1:12

Chromosome

chr4

Gene Name

TAPT1-AS1

Start

16226662

CPC Label

coding

End

16233494

Cancer

PRAD

Strand

+

Peptide

RSDGFSVTFQNSK

Modified Peptide

‚Äč

Peptide Length

13

ORF Length

42

Open Reading Frame (ORF)

MYLYVLCISPSFLGMRRSDGFSVTFQNSKAVFLTPGLRVSTF

Conservation Score

0.171

PhyloCSF Frame 1

-5.234

No. of Spectra

1

CPC Coding Probability

0.731029

PhyloCSF Frame 2 

-4.794

CNTI Index

coding

Max Probability

0.3905

PhyloCSF Frame 3

-2.548

CNTI Score

0.712707298