McDonnell Genome Institute

Washington University

Transcript

TAPT1-AS1:1

Chromosome

chr4

Gene Name

TAPT1-AS1

Start

16226662

CPC Label

noncoding

End

16258187

Cancer

OV

Strand

+

Peptide

AGASGARVGDPAGAGR

Modified Peptide

n[145]AGASGARVGDPAGAGR

Peptide Length

16

ORF Length

134

Open Reading Frame (ORF)

LARPAGAPRRAPCSRAARSRRAGASGARVGDPAGAGRGWRRRAAGRPWSPGEAAATTAARSLRGVRRSAQGLFCRLGARSAPAPPARSWHCWRGRGGGGPAPDHRPPRAPALPARYFGSISSAYLCLPVTFPGL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.292599

PhyloCSF Frame 2 

3.134

CNTI Index

noncoding

Max Probability

0.7528

PhyloCSF Frame 3

0

CNTI Score

-0.276488059