McDonnell Genome Institute

Washington University

Transcript

TAF1A-AS1:12

Chromosome

chr1

Gene Name

TAF1A-AS1

Start

222589961

CPC Label

noncoding

End

222602654

Cancer

OSCC

Strand

+

Peptide

HQIFDFCGNGAK

Modified Peptide

n[145]HQIFDFCGNGAK

Peptide Length

12

ORF Length

42

Open Reading Frame (ORF)

LKITWKSQTVEIELYRPHPGICCTFVSKHQIFDFCGNGAKVN

Conservation Score

1

PhyloCSF Frame 1

-4.638

No. of Spectra

27

CPC Coding Probability

0.0317592

PhyloCSF Frame 2 

-4.536

CNTI Index

noncoding

Max Probability

0.8644

PhyloCSF Frame 3

-5.758

CNTI Score

-0.344673629