McDonnell Genome Institute

Washington University

Transcript

SYNGAP1-AS1:9

Chromosome

chr6

Gene Name

SYNGAP1-AS1

Start

33448989

CPC Label

noncoding

End

33454428

Cancer

OV

Strand

-

Peptide

GGNFMLR

Modified Peptide

n[145]GGNFM[147]LR

Peptide Length

7

ORF Length

60

Open Reading Frame (ORF)

LASPVYIPCPSHPPPLETPSHPSPIRGGNFMLRNKGRQYSKTSLIQTPVDLEFLHNLKKN

Conservation Score

1

PhyloCSF Frame 1

-3.162

No. of Spectra

41

CPC Coding Probability

0.171129

PhyloCSF Frame 2 

-2.739

CNTI Index

noncoding

Max Probability

0.7485

PhyloCSF Frame 3

-4.106

CNTI Score

-0.387076168