McDonnell Genome Institute

Washington University

Transcript

STXBP5-AS1:8

Chromosome

chr6

Gene Name

STXBP5-AS1

Start

146861805

CPC Label

noncoding

End

147119463

Cancer

OV

Strand

-

Peptide

EEILSVTGSWFMLSLK

Modified Peptide

n[145]EEILSVTGSWFMLSLK

Peptide Length

16

ORF Length

67

Open Reading Frame (ORF)

LNQVWNIIEMRPTKEEILSVTGSWFMLSLKFDLLNISRKTLSGEYRSSEQLSTDFVIRLPFQKLSVT

Conservation Score

1

PhyloCSF Frame 1

-5.272

No. of Spectra

1

CPC Coding Probability

0.0511096

PhyloCSF Frame 2 

-4.896

CNTI Index

noncoding

Max Probability

0.619

PhyloCSF Frame 3

-4.388

CNTI Score

-0.461361698