McDonnell Genome Institute

Washington University

Transcript

STXBP5-AS1:11

Chromosome

chr6

Gene Name

STXBP5-AS1

Start

146864458

CPC Label

noncoding

End

146911606

Cancer

OV

Strand

-

Peptide

TLSGEYR

Modified Peptide

n[145]TLSGEYR

Peptide Length

7

ORF Length

63

Open Reading Frame (ORF)

MGKIITNKGLLRPFICVTGSWFMLSLKFDLLNISRKTLSGEYRSSEQLSTDFVIRLPFQKVQK

Conservation Score

0.961

PhyloCSF Frame 1

-5.155

No. of Spectra

1

CPC Coding Probability

0.123618

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.3026

PhyloCSF Frame 3

-4.939

CNTI Score

-0.472102625