McDonnell Genome Institute

Washington University

Transcript

STXBP5-AS1:1

Chromosome

chr6

Gene Name

STXBP5-AS1

Start

146843113

CPC Label

noncoding

End

147204614

Cancer

HCC

Strand

-

Peptide

HQGELPVPGR

Modified Peptide

‚Äč

Peptide Length

10

ORF Length

68

Open Reading Frame (ORF)

LTHNIGTSSFGKHQGELPVPGRSCPCPTDTPQYFLFCLVLLLLSTNNCDSLPGSFLWPQEPAHLIGTP

Conservation Score

0.337

PhyloCSF Frame 1

-4.744

No. of Spectra

2

CPC Coding Probability

0.0280716

PhyloCSF Frame 2 

-4.968

CNTI Index

noncoding

Max Probability

0.6236

PhyloCSF Frame 3

-4.368

CNTI Score

-0.358243851