McDonnell Genome Institute

Washington University

Transcript

STX17-AS1:6

Chromosome

chr9

Gene Name

STX17-AS1

Start

99879460

CPC Label

coding

End

99906599

Cancer

OV

Strand

-

Peptide

TLEENLGNTIQDIGTGKDFMSETPK

Modified Peptide

n[145]TLEENLGNTIQDIGTGKDFMSETPK

Peptide Length

25

ORF Length

325

Open Reading Frame (ORF)

LRHFLNKKINSRWIKDLNVRPKTIKTLEENLGNTIQDIGTGKDFMSETPKAMATKAKIDKWDLIKLKSFCTPKETIIRVNRPPTEWEKIFANYLSDKGLISRIYKELKQIYKKKTNNPIKKWVKDMNRHFSKEDIYAGNRHMKKCSSSLAIREMQIKTTVRYHLTPVRMAIIKKSGNNRCWRGCGEIGTLLHCWWACKLVQPLWKTVWRFLKDLELEIPFDPAIPLLGIYPKDYKSCCYKDTCTRMFIVALFTIAKTWNQPKCPSMIDWIKKMWHIYTMEYYAAIKNDEFMSFVGTWMKLETIILSKLSQGQKTKHRMFSLIGGN

Conservation Score

0.652

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.993887

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6821

PhyloCSF Frame 3

0

CNTI Score

-0.359085193