McDonnell Genome Institute

Washington University

Transcript

STT3A-AS1:5

Chromosome

chr11

Gene Name

STT3A-AS1

Start

125584311

CPC Label

noncoding

End

125592486

Cancer

CRC

Strand

-

Peptide

YLYFVLNSMAGFR

Modified Peptide

‚Äč

Peptide Length

13

ORF Length

81

Open Reading Frame (ORF)

LMNFFSSKCFRKAEWKQTLPLRVRKYLYFVLNSMAGFRILGTKLGPTHPTPYAHRHIKAHFQASVTILFVIHCALRNLTPI

Conservation Score

0.963

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.162037

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6498

PhyloCSF Frame 3

0

CNTI Score

-0.325066059