McDonnell Genome Institute

Washington University

Transcript

STK32A-AS1:12

Chromosome

chr5

Gene Name

STK32A-AS1

Start

147172764

CPC Label

noncoding

End

147234878

Cancer

OSCC

Strand

-

Peptide

DYGLVLK

Modified Peptide

n[145]DYGLVLK

Peptide Length

7

ORF Length

56

Open Reading Frame (ORF)

MDYGLVLKIKRVWLFNTNNKVWEFLHSGRERQVVRVAKCSLGRKVNRKTWFKSRQV

Conservation Score

0.922

PhyloCSF Frame 1

0

No. of Spectra

18

CPC Coding Probability

0.190578

PhyloCSF Frame 2 

-5.591

CNTI Index

noncoding

Max Probability

0.9793

PhyloCSF Frame 3

0

CNTI Score

-0.354071916