McDonnell Genome Institute

Washington University

Transcript

STK24-AS1:6

Chromosome

chr13

Gene Name

STK24-AS1

Start

98577254

CPC Label

noncoding

End

98578745

Cancer

OV

Strand

+

Peptide

RGREGASAGAGAGR

Modified Peptide

n[145]RGREGASAGAGAGR

Peptide Length

14

ORF Length

81

Open Reading Frame (ORF)

LSARPGSQLLLRRSHAPAGGRRGREGASAGAGAGRDRVGAGGWPRAHRAGAGASLGRGPLFPPASPPRPGGLWENASRASP

Conservation Score

0.664

PhyloCSF Frame 1

-1.098

No. of Spectra

2

CPC Coding Probability

0.0139075

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1828

PhyloCSF Frame 3

-0.305

CNTI Score

-0.297672432