McDonnell Genome Institute

Washington University

Transcript

STEAP3-AS1:1

Chromosome

chr2

Gene Name

STEAP3-AS1

Start

119244421

CPC Label

noncoding

End

119249071

Cancer

OV

Strand

-

Peptide

TSSHLTLDLTVYHSLARR

Modified Peptide

n[145]TSSHLTLDLTVYHSLARR

Peptide Length

18

ORF Length

61

Open Reading Frame (ORF)

LMTRKGEHVPMLVYILHLGAVLLMLSLKHGEQLEGRTSSHLTLDLTVYHSLARRQCSVFAE

Conservation Score

0.609

PhyloCSF Frame 1

-3.654

No. of Spectra

1

CPC Coding Probability

0.440247

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8068

PhyloCSF Frame 3

-1.97

CNTI Score

-0.343136017