McDonnell Genome Institute

Washington University

Transcript

STEAP2-AS1:6

Chromosome

chr7

Gene Name

STEAP2-AS1

Start

90208733

CPC Label

noncoding

End

90211635

Cancer

OV

Strand

-

Peptide

EFNKHEILRNSQLQK

Modified Peptide

n[145]EFNKHEILRNSQLQK

Peptide Length

15

ORF Length

40

Open Reading Frame (ORF)

MLLCFKTKEFNKHEILRNSQLQKIWNQPKCPSTNEWIKKI

Conservation Score

0.918

PhyloCSF Frame 1

0

No. of Spectra

10

CPC Coding Probability

0.0779172

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7714

PhyloCSF Frame 3

0

CNTI Score

-0.345656577