McDonnell Genome Institute

Washington University

Transcript

ST3GAL5-AS1:2

Chromosome

chr2

Gene Name

ST3GAL5-AS1

Start

85889154

CPC Label

noncoding

End

85917199

Cancer

OV

Strand

+

Peptide

QTLGALQR

Modified Peptide

n[145]QTLGALQR

Peptide Length

8

ORF Length

54

Open Reading Frame (ORF)

MCLFSLYKQTLGALQRLDLWQWKLAALRSSFQMFGARENYRAVVNSLGSAVRKI

Conservation Score

0.879

PhyloCSF Frame 1

-5.185

No. of Spectra

8

CPC Coding Probability

0.0615734

PhyloCSF Frame 2 

-5.605

CNTI Index

noncoding

Max Probability

0.9157

PhyloCSF Frame 3

-3.768

CNTI Score

-0.339522187