McDonnell Genome Institute

Washington University

Transcript

SSTR5-AS1:9

Chromosome

chr16

Gene Name

SSTR5-AS1

Start

1076378

CPC Label

noncoding

End

1078621

Cancer

OV

Strand

-

Peptide

ATVLAGGCGAGPRPLK

Modified Peptide

n[145]ATVLAGGCGAGPRPLK

Peptide Length

16

ORF Length

78

Open Reading Frame (ORF)

LTLEAPQSTGRPQQLPGKATVLAGGCGAGPRPLKSGRQGKESWGRGSPEHKADSTKRKPSVPNKPRNQHPQARMAQTH

Conservation Score

0.014

PhyloCSF Frame 1

-2.963

No. of Spectra

3

CPC Coding Probability

0.141342

PhyloCSF Frame 2 

-4.456

CNTI Index

noncoding

Max Probability

0.8166

PhyloCSF Frame 3

-4.41

CNTI Score

-0.298298893