McDonnell Genome Institute

Washington University

Transcript

SSSCA1-AS1:4

Chromosome

chr11

Gene Name

SSSCA1-AS1

Start

65569659

CPC Label

noncoding

End

65570273

Cancer

OV

Strand

-

Peptide

LFLGELQVK

Modified Peptide

n[145]LFLGELQVK

Peptide Length

9

ORF Length

33

Open Reading Frame (ORF)

LRAGPGRVGAFLHTLATIRLFLGELQVKITRAL

Conservation Score

0.731

PhyloCSF Frame 1

-5.615

No. of Spectra

1

CPC Coding Probability

0.113159

PhyloCSF Frame 2 

-4.334

CNTI Index

noncoding

Max Probability

0.9116

PhyloCSF Frame 3

-4.108

CNTI Score

-0.299837555