McDonnell Genome Institute

Washington University

Transcript

SSSCA1-AS1:2

Chromosome

chr11

Gene Name

SSSCA1-AS1

Start

65568481

CPC Label

noncoding

End

65570423

Cancer

EOGC

Strand

-

Peptide

VLGLQRRATAPSLR

Modified Peptide

n[145]VLGLQRRATAPSLR

Peptide Length

14

ORF Length

101

Open Reading Frame (ORF)

MLPRLVSNSWTQVILTPQPPKVLGLQRRATAPSLRLTRGTVSEPSLGLQPVCTDPQVITVSSSQPYPEFLSAPTMSPSWPISTQLSILPRTYKEPYMSPLT

Conservation Score

0.118

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.188759

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4569

PhyloCSF Frame 3

0

CNTI Score

-0.299837555