McDonnell Genome Institute

Washington University

Transcript

SRP14-AS1:32

Chromosome

chr15

Gene Name

SRP14-AS1

Start

40039319

CPC Label

noncoding

End

40067512

Cancer

OSCC

Strand

+

Peptide

GWLGLGR

Modified Peptide

n[145]GWLGLGR

Peptide Length

7

ORF Length

64

Open Reading Frame (ORF)

MGSLEGHGREFGVYLKNNEKKKLVRKTTYCIFPFLQNIQNRQTQRDRKQIRGWLGLGRLGGNGE

Conservation Score

0.624

PhyloCSF Frame 1

-5.034

No. of Spectra

23

CPC Coding Probability

0.170387

PhyloCSF Frame 2 

-5.063

CNTI Index

noncoding

Max Probability

0.9978

PhyloCSF Frame 3

-4.846

CNTI Score

-0.328062462