McDonnell Genome Institute

Washington University

Transcript

SRP14-AS1:28

Chromosome

chr15

Gene Name

SRP14-AS1

Start

40039319

CPC Label

noncoding

End

40075839

Cancer

OV

Strand

+

Peptide

LILKSSRSGAVGDPR

Modified Peptide

n[145]LILKSSRSGAVGDPR

Peptide Length

15

ORF Length

99

Open Reading Frame (ORF)

LVGKAQRDSVFLSGFLSRRRSFLSAAPLPHLSRGNRSLSSPPHPKGPFLRLILKSSRSGAVGDPRHKQRGLMMLPRLGSSSWIQAILPPWPLSVLGLQV

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.253688

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4042

PhyloCSF Frame 3

0

CNTI Score

-0.294812578