McDonnell Genome Institute

Washington University

Transcript

SRP14-AS1:27

Chromosome

chr15

Gene Name

SRP14-AS1

Start

40039319

CPC Label

noncoding

End

40075169

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

LRPDGAR

Modified Peptide

n[145]LRPDGAR

Peptide Length

7

ORF Length

71

Open Reading Frame (ORF)

LAGGLAWRQHRLRPDGARADLARMGPTAGRFSHPGHKGTRPALGAGCHRGCAPCHRLHCQCGRAACQALSP

Conservation Score

1

PhyloCSF Frame 1

0.848

No. of Spectra

54

CPC Coding Probability

0.249008

PhyloCSF Frame 2 

1.254

CNTI Index

coding

Max Probability

0.9953

PhyloCSF Frame 3

-1.363

CNTI Score

0.700322291