McDonnell Genome Institute

Washington University

Transcript

SRGAP3-AS3:2

Chromosome

chr3

Gene Name

SRGAP3-AS3

Start

9216894

CPC Label

coding

End

9219508

Cancer

BRCA-Luminal A

Strand

+

Peptide

GILQFHSR

Modified Peptide

n[145]GILQFHSR

Peptide Length

8

ORF Length

57

Open Reading Frame (ORF)

LAHQERGILQFHSRKTFLARLSNNANSLISEVVSPLLQEVPIRSLMVVEDSASDEGA

Conservation Score

0.367

PhyloCSF Frame 1

-4.247

No. of Spectra

25

CPC Coding Probability

0.646355

PhyloCSF Frame 2 

-4.685

CNTI Index

noncoding

Max Probability

0.9996

PhyloCSF Frame 3

-4.816

CNTI Score

-0.352539803