McDonnell Genome Institute

Washington University

Transcript

SREBF2-AS1:6

Chromosome

chr22

Gene Name

SREBF2-AS1

Start

41826200

CPC Label

noncoding

End

41832911

Cancer

PRAD

Strand

-

Peptide

HVLHCLTQR

Modified Peptide

HVLHCLTQR

Peptide Length

9

ORF Length

78

Open Reading Frame (ORF)

MFRYLPWIGHVLRVTEDNFVYGFSFTSSDTFPFFPQHLSFSSSSPNLSGFSSDITSSRKPSNWINQKHVLHCLTQRWG

Conservation Score

0.04

PhyloCSF Frame 1

-5.233

No. of Spectra

20

CPC Coding Probability

0.0466819

PhyloCSF Frame 2 

-4.977

CNTI Index

noncoding

Max Probability

0.8725

PhyloCSF Frame 3

-4.703

CNTI Score

-0.3064454