McDonnell Genome Institute

Washington University

Transcript

SREBF2-AS1:5

Chromosome

chr22

Gene Name

SREBF2-AS1

Start

41831214

CPC Label

noncoding

End

41834665

Cancer

OV

Strand

-

Peptide

LQMMVQVIK

Modified Peptide

n[145]LQMMVQVIK

Peptide Length

9

ORF Length

44

Open Reading Frame (ORF)

LWQGNKWFLPSESFQSSKKKNQKSHTRIKHKNKLQMMVQVIKER

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

26

CPC Coding Probability

0.115502

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9573

PhyloCSF Frame 3

0

CNTI Score

-0.262433315