McDonnell Genome Institute

Washington University

Transcript

SPATA41:9

Chromosome

chr15

Gene Name

SPATA41

Start

100371963

CPC Label

noncoding

End

100373823

Cancer

OV

Strand

-

Peptide

RAWPGCTGVWAEGAGAR

Modified Peptide

n[145]RAWPGCTGVWAEGAGAR

Peptide Length

17

ORF Length

106

Open Reading Frame (ORF)

LHPSRPPRQPRPRPWAGREGCEAGRRGALRPERVRTTFPRWRRRRRRAWPGCTGVWAEGAGARGREGKSRSGGEGEGRRAPVPGCTEAASSGDWRSLPAFRAYSRL

Conservation Score

0.127

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0511186

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8521

PhyloCSF Frame 3

-3.869

CNTI Score

-0.264908157